| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KF916014.1 | complete | 228 | 1-687(+) |
Amino Acid sequence : | |||
| MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANNSVKGTIDRYKKACTDTSNSGTVSEANSQYYQQEASKLLQQIAQLQNSNRNLMGESLSTMS PRELRQLEGKLEKGINKIRAKKNELLYAEIEYMQKREMELQNDNMYLRNKISENERAQQHMNMLPSATATEYEAMPPFDSRSFLQANLVDPNHHYSHQQQTALQLGFV* | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 26,298.492 | ||
| Theoretical pI: | 9.137 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16390 16515 | ||
| Instability index: | 60.178 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.801 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.224 | ||
| sheet | 0.298 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KF916014.1 | complete | 228 | 1-687(+) |
Amino Acid sequence : | |||
| MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANNSVKGTIDRYKKACTDTSNSGTVSEANSQYYQQEASKLLQQIAQLQNSNRNLMGESLSTMS PRELRQLEGKLEKGINKIRAKKNELLYAEIEYMQKREMELQNDNMYLRNKISENERAQQHMNMLPSATATEYEAMPPFDSRSFLQANLVDPNHHYSHQQQTALQLGFV* | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 26,298.492 | ||
| Theoretical pI: | 9.137 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16390 16515 | ||
| Instability index: | 60.178 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.801 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.224 | ||
| sheet | 0.298 | ||