| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KJ004760.1 | 3prime_partial | 107 | 1-321(+) |
Amino Acid sequence : | |||
| MSPKFIERIKKYCDINGGPATFIQAAVPEIVRQTQEVFFRKTINILKQTSDICYQKLEDIEGITCPTKPKGAMAFMVKVNISRMKDISDDIDFCFKLAKEESVIILP | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,458.876 | ||
| Theoretical pI: | 5.324 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
| Instability index: | 35.325 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.006 | ||
Secondary Structure Fraction | |||
| Helix | 0.393 | ||
| turn | 0.234 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KJ004760.1 | internal | 107 | 321-1(-) |
Amino Acid sequence : | |||
| WKDYNRFLLGQLETEVDVITNVFHSGNIYLHHESHCSFRLSGTSNAFDVFELLVTNIRSLLQNVDCFSEENLLCLSHNFWDCSLYECSRTSINVTVFLNALNKLWAH | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,458.876 | ||
| Theoretical pI: | 5.324 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
| Instability index: | 35.325 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.006 | ||
Secondary Structure Fraction | |||
| Helix | 0.393 | ||
| turn | 0.234 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KJ004760.1 | 3prime_partial | 107 | 1-321(+) |
Amino Acid sequence : | |||
| MSPKFIERIKKYCDINGGPATFIQAAVPEIVRQTQEVFFRKTINILKQTSDICYQKLEDIEGITCPTKPKGAMAFMVKVNISRMKDISDDIDFCFKLAKEESVIILP | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,458.876 | ||
| Theoretical pI: | 5.324 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
| Instability index: | 35.325 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.006 | ||
Secondary Structure Fraction | |||
| Helix | 0.393 | ||
| turn | 0.234 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KJ004760.1 | internal | 107 | 321-1(-) |
Amino Acid sequence : | |||
| WKDYNRFLLGQLETEVDVITNVFHSGNIYLHHESHCSFRLSGTSNAFDVFELLVTNIRSLLQNVDCFSEENLLCLSHNFWDCSLYECSRTSINVTVFLNALNKLWAH | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,458.876 | ||
| Theoretical pI: | 5.324 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
| Instability index: | 35.325 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.006 | ||
Secondary Structure Fraction | |||
| Helix | 0.393 | ||
| turn | 0.234 | ||
| sheet | 0.243 | ||