| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KJ381079.1 | complete | 481 | 1-1446(+) |
Amino Acid sequence : | |||
| MGSEDRSLSILFFPFMAQGHMLPMLDMAKLFALYGVKSIVVTTPANVPIVNSVIDQPDVSTLHPIQLRLIPFPSDTGLPEGCENVSSIPPRDMPTVHVTFFSATAKLREPFGKVLEDLRP DCIVTDMFFPWTYDVAAELGIPRIVFHGTNFFSLCVTDSLERYKPVENLRSDAESVIIPGLPHRIEVLRSQIPEYEKSKADFVREVTESESKSYGAVVNSFFELEPDYARHYREVVGRRA WHIGPLALANDSTTDKSSRGYKTAIDRNDCLKWLDSKSLRSVVYVCFGSMSDFSDAQLREMASGLEASNHPFIWVVRKSGKEWLPEGFEERVQERGLIIRGWAPQILILNHRAVGGFMTH CGWNSSLEAVSAGLPLVTWPLFAEQFYNERFIVDVLRIGVSVGAKRHGMSAEEREVVEAEMVKKAVDGVMGDGEEAEGRRRRARELGEKARKAVEKGGSSYEDMRNLVEELKSDSKLTVG C* | |||
Physicochemical properties | |||
| Number of amino acids: | 481 | ||
| Molecular weight: | 13,043.311 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 95.989 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.759 | ||
Secondary Structure Fraction | |||
| Helix | 0.138 | ||
| turn | 0.488 | ||
| sheet | 0.114 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KJ381079.1 | complete | 239 | 726-7(-) |
Amino Acid sequence : | |||
| MPCSSPDYLPVVTSIVGLQLEEAVDHRTVALGFGLCHLPNKIRLRFFIFRYLRPEHFDPMGKAGDDHRLGIRPKVLDRLVPLQTISDAEGEEIGAMEYDPRYPELGGDIVRPGEEHVGHD AVRAEVFQNLPERLAEFRRGGEEGDVDGRHVPWRDGGDVLATFRKAGVRRERDETELDRMESRDVGLVDDGVDDGDVGRSGDDDGLDAVKGEELGHVEHREHVALGHEGEEENAETAIF* | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 13,043.311 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 95.989 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.759 | ||
Secondary Structure Fraction | |||
| Helix | 0.138 | ||
| turn | 0.488 | ||
| sheet | 0.114 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KJ381079.1 | complete | 191 | 720-1295(+) |
Amino Acid sequence : | |||
| MAYWPPCSSQRFHHRQIFARIQDRDRPQRLPEMARQQEPPLGRVRLFREHERLQRRSAPRDGFGPRGLQPSVHLGGEEEREGMAARRVRRKSAGKRSDHKRMGPADTDPEPPGGRWVHDA LRVELEPRGGECRPAVGDVASICRAVLQREVYRRRAEDWSVGRSEASRDERGGEGSGGSGNGKEGSGWSYG* | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 13,043.311 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 95.989 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.759 | ||
Secondary Structure Fraction | |||
| Helix | 0.138 | ||
| turn | 0.488 | ||
| sheet | 0.114 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KJ381079.1 | 5prime_partial | 156 | 3-473(+) |
Amino Acid sequence : | |||
| GLRRSQSQHSLLPLHGPRPHAPDARHGQALRPLRRQVHRRHHSGQRPHRQLRHRPTRRLDSPSDPTPSHPVPFGHRPSGRLRERLLHPSTGHADRPRHLLLRHGETPRAVREGSGRPPPG LHRDRHVLPLDVRCRRRARDTEDRIPWHQFLLPLRH* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 13,043.311 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 95.989 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.759 | ||
Secondary Structure Fraction | |||
| Helix | 0.138 | ||
| turn | 0.488 | ||
| sheet | 0.114 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KJ381079.1 | complete | 144 | 533-99(-) |
Amino Acid sequence : | |||
| MITDSASDRRFSTGLYRSKLSVTQREKKLVPWNTILGIPSSAATSYVQGKNMSVTMQSGRRSSRTFPNGSRSFAVAEKKVTWTVGMSRGGMEETFSQPSGRPVSEGNGMRRSWIGWRVET SGWSMTELTMGTLAGVVTTMDLTP* | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 13,043.311 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 95.989 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.759 | ||
Secondary Structure Fraction | |||
| Helix | 0.138 | ||
| turn | 0.488 | ||
| sheet | 0.114 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KJ381079.1 | 5prime_partial | 123 | 2-373(+) |
Amino Acid sequence : | |||
| WAQKIAVSAFSSSPSWPKATCSRCSTWPSSSPFTASSPSSSPLRPTSPSSTPSSTNPTSRLSIRSNSVSSRSLRTPAFRKVARTSPPSLHGTCRPSTSPSSPPRRNSASRSGRFWKTSAR TAS* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 13,043.311 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 95.989 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.759 | ||
Secondary Structure Fraction | |||
| Helix | 0.138 | ||
| turn | 0.488 | ||
| sheet | 0.114 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KJ381079.1 | complete | 481 | 1-1446(+) |
Amino Acid sequence : | |||
| MGSEDRSLSILFFPFMAQGHMLPMLDMAKLFALYGVKSIVVTTPANVPIVNSVIDQPDVSTLHPIQLRLIPFPSDTGLPEGCENVSSIPPRDMPTVHVTFFSATAKLREPFGKVLEDLRP DCIVTDMFFPWTYDVAAELGIPRIVFHGTNFFSLCVTDSLERYKPVENLRSDAESVIIPGLPHRIEVLRSQIPEYEKSKADFVREVTESESKSYGAVVNSFFELEPDYARHYREVVGRRA WHIGPLALANDSTTDKSSRGYKTAIDRNDCLKWLDSKSLRSVVYVCFGSMSDFSDAQLREMASGLEASNHPFIWVVRKSGKEWLPEGFEERVQERGLIIRGWAPQILILNHRAVGGFMTH CGWNSSLEAVSAGLPLVTWPLFAEQFYNERFIVDVLRIGVSVGAKRHGMSAEEREVVEAEMVKKAVDGVMGDGEEAEGRRRRARELGEKARKAVEKGGSSYEDMRNLVEELKSDSKLTVG C* | |||
Physicochemical properties | |||
| Number of amino acids: | 481 | ||
| Molecular weight: | 13,043.311 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 95.989 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.759 | ||
Secondary Structure Fraction | |||
| Helix | 0.138 | ||
| turn | 0.488 | ||
| sheet | 0.114 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KJ381079.1 | complete | 239 | 726-7(-) |
Amino Acid sequence : | |||
| MPCSSPDYLPVVTSIVGLQLEEAVDHRTVALGFGLCHLPNKIRLRFFIFRYLRPEHFDPMGKAGDDHRLGIRPKVLDRLVPLQTISDAEGEEIGAMEYDPRYPELGGDIVRPGEEHVGHD AVRAEVFQNLPERLAEFRRGGEEGDVDGRHVPWRDGGDVLATFRKAGVRRERDETELDRMESRDVGLVDDGVDDGDVGRSGDDDGLDAVKGEELGHVEHREHVALGHEGEEENAETAIF* | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 13,043.311 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 95.989 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.759 | ||
Secondary Structure Fraction | |||
| Helix | 0.138 | ||
| turn | 0.488 | ||
| sheet | 0.114 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KJ381079.1 | complete | 191 | 720-1295(+) |
Amino Acid sequence : | |||
| MAYWPPCSSQRFHHRQIFARIQDRDRPQRLPEMARQQEPPLGRVRLFREHERLQRRSAPRDGFGPRGLQPSVHLGGEEEREGMAARRVRRKSAGKRSDHKRMGPADTDPEPPGGRWVHDA LRVELEPRGGECRPAVGDVASICRAVLQREVYRRRAEDWSVGRSEASRDERGGEGSGGSGNGKEGSGWSYG* | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 13,043.311 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 95.989 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.759 | ||
Secondary Structure Fraction | |||
| Helix | 0.138 | ||
| turn | 0.488 | ||
| sheet | 0.114 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KJ381079.1 | 5prime_partial | 156 | 3-473(+) |
Amino Acid sequence : | |||
| GLRRSQSQHSLLPLHGPRPHAPDARHGQALRPLRRQVHRRHHSGQRPHRQLRHRPTRRLDSPSDPTPSHPVPFGHRPSGRLRERLLHPSTGHADRPRHLLLRHGETPRAVREGSGRPPPG LHRDRHVLPLDVRCRRRARDTEDRIPWHQFLLPLRH* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 13,043.311 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 95.989 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.759 | ||
Secondary Structure Fraction | |||
| Helix | 0.138 | ||
| turn | 0.488 | ||
| sheet | 0.114 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KJ381079.1 | complete | 144 | 533-99(-) |
Amino Acid sequence : | |||
| MITDSASDRRFSTGLYRSKLSVTQREKKLVPWNTILGIPSSAATSYVQGKNMSVTMQSGRRSSRTFPNGSRSFAVAEKKVTWTVGMSRGGMEETFSQPSGRPVSEGNGMRRSWIGWRVET SGWSMTELTMGTLAGVVTTMDLTP* | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 13,043.311 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 95.989 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.759 | ||
Secondary Structure Fraction | |||
| Helix | 0.138 | ||
| turn | 0.488 | ||
| sheet | 0.114 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KJ381079.1 | 5prime_partial | 123 | 2-373(+) |
Amino Acid sequence : | |||
| WAQKIAVSAFSSSPSWPKATCSRCSTWPSSSPFTASSPSSSPLRPTSPSSTPSSTNPTSRLSIRSNSVSSRSLRTPAFRKVARTSPPSLHGTCRPSTSPSSPPRRNSASRSGRFWKTSAR TAS* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 13,043.311 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 95.989 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.759 | ||
Secondary Structure Fraction | |||
| Helix | 0.138 | ||
| turn | 0.488 | ||
| sheet | 0.114 | ||