Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KJ667638.1 | internal | 231 | 3-695(+) |
Amino Acid sequence : | |||
FKAGVKDYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEQNQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRA LRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALFKAQAETGEIKGHYLNAT | |||
Physicochemical properties | |||
Number of amino acids: | 231 | ||
Molecular weight: | 25,918.066 | ||
Theoretical pI: | 7.009 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37360 37610 | ||
Instability index: | 30.564 | ||
aromaticity | 0.126 | ||
GRAVY | -0.403 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.216 | ||
sheet | 0.251 |