Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KJ667655.1 | internal | 238 | 3-716(+) |
Amino Acid sequence : | |||
ETKAFVGFKAGVKDYKLTYYTPDYQTLDTDILAAFRVTAQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEESQFIAYVAYPLDLFEEGSVTNMFTSIVGNVF GFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCTEALYKAQAETGEVKGHYLNAT | |||
Physicochemical properties | |||
Number of amino acids: | 238 | ||
Molecular weight: | 26,582.770 | ||
Theoretical pI: | 6.399 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37360 37610 | ||
Instability index: | 33.961 | ||
aromaticity | 0.126 | ||
GRAVY | -0.368 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.214 | ||
sheet | 0.252 |