| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KJ667655.1 | internal | 238 | 3-716(+) |
Amino Acid sequence : | |||
| ETKAFVGFKAGVKDYKLTYYTPDYQTLDTDILAAFRVTAQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEESQFIAYVAYPLDLFEEGSVTNMFTSIVGNVF GFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCTEALYKAQAETGEVKGHYLNAT | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 26,582.770 | ||
| Theoretical pI: | 6.399 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37360 37610 | ||
| Instability index: | 33.961 | ||
| aromaticity | 0.126 | ||
| GRAVY | -0.368 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.214 | ||
| sheet | 0.252 | ||