| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KJ735966.1 | internal | 177 | 1-531(+) |
Amino Acid sequence : | |||
| VGFKAGVKDYKLTYYTPDYVTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKAL RALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGR | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 19,556.022 | ||
| Theoretical pI: | 8.366 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
| Instability index: | 25.329 | ||
| aromaticity | 0.119 | ||
| GRAVY | -0.315 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.243 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KJ735966.1 | internal | 177 | 1-531(+) |
Amino Acid sequence : | |||
| VGFKAGVKDYKLTYYTPDYVTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKAL RALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGR | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 19,556.022 | ||
| Theoretical pI: | 8.366 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
| Instability index: | 25.329 | ||
| aromaticity | 0.119 | ||
| GRAVY | -0.315 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.243 | ||
| sheet | 0.226 | ||