| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KJ749874.1 | internal | 145 | 2-436(+) |
Amino Acid sequence : | |||
| FRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFLIRGLIRQDLAANIGVAKSQIREKEPIVWEILQEVMRGHPVLLNRAPTLHRLGIQAFQPILVEGRAICLHPLVCKGF NADFDGDQMAVHVPLSLEAQAEARL | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 16,178.792 | ||
| Theoretical pI: | 8.617 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 39.061 | ||
| aromaticity | 0.055 | ||
| GRAVY | 0.157 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.193 | ||
| sheet | 0.303 | ||