| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KJ749956.1 | internal | 149 | 1-447(+) |
Amino Acid sequence : | |||
| RFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFLIRGLIRQDLAANIGVAKSQIREKEPIVWEILQEVMRGHPVLLNRAPTLHRLGIQAFQPILVEGRAICLHPLVCKG FNSDFDGDQMAVHVHLSLEAQEYAHLLFF | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,871.555 | ||
| Theoretical pI: | 8.601 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 39.870 | ||
| aromaticity | 0.074 | ||
| GRAVY | 0.145 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.188 | ||
| sheet | 0.289 | ||