Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KJ841415.1 | internal | 153 | 3-461(+) |
Amino Acid sequence : | |||
TYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPV AYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIK | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 17,071.173 | ||
Theoretical pI: | 5.403 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
Instability index: | 32.288 | ||
aromaticity | 0.118 | ||
GRAVY | -0.293 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.216 | ||
sheet | 0.229 |