Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM000005.1 | internal | 281 | 1-843(+) |
Amino Acid sequence : | |||
TYVSDVQISYPIHLEKLVQTLRYWVKDTSSLHLLRFFLHEYWNWNSLIFPNNLISFFAKSNPRLFLFLYNSHVYEYESIFFFLRKQSFHLRSTFFRVLLERIYFFGKIEHFAEVFANDFQ AILWLFKDPFMHYVRYQGKSILASKDTPLLLKKWKYYLVNLCQCHFSVWFQPAKICINPLSKQSLDFLGYLSSLRLNLSVVRSQMLENAFLIDNAMKKVDTRIPIIPLIRSLAKTKFCNA AGHPISQPIWAGSSDSDIINRFVRICRNLSHYYSGSSKEKS | |||
Physicochemical properties | |||
Number of amino acids: | 281 | ||
Molecular weight: | 33,381.460 | ||
Theoretical pI: | 9.615 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 60850 61100 | ||
Instability index: | 34.518 | ||
aromaticity | 0.171 | ||
GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.423 | ||
turn | 0.221 | ||
sheet | 0.214 |