Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM009046.1 | internal | 176 | 530-3(-) |
Amino Acid sequence : | |||
GKEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASNIGVAKSQIRGKERIVWEILQEVMQGHPVLLNRAPTLHKLGIQAFQPVLVEGRAICLHPL VCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVPTQDWLM | |||
Physicochemical properties | |||
Number of amino acids: | 176 | ||
Molecular weight: | 19,543.707 | ||
Theoretical pI: | 8.964 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 37.704 | ||
aromaticity | 0.057 | ||
GRAVY | 0.124 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.222 | ||
sheet | 0.284 |