| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KM009047.1 | internal | 176 | 530-3(-) |
Amino Acid sequence : | |||
| GKEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASNIGVAKSQIRGKERIVWEILQEVMQGHPVLLNRAPTLHKLGIQAFQPVLVEGRAICLHPL VCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVPTQDWLM | |||
Physicochemical properties | |||
| Number of amino acids: | 176 | ||
| Molecular weight: | 19,543.707 | ||
| Theoretical pI: | 8.964 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 37.704 | ||
| aromaticity | 0.057 | ||
| GRAVY | 0.124 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.222 | ||
| sheet | 0.284 | ||