Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM051109.1 | complete | 183 | 387-938(+) |
Amino Acid sequence : | |||
MRNPAVMAKAQAEVRAALKEKTNWDVDDVQELKYMKSVVKETMRMHPPIPLIPRSCREECVVNGYTIPNKARIMINVWSMGRNPLYWEKPDTFWPERFDQVSKDFMGNDFEFVPFGAGRR ICPGLNFGLANVEVPLAQLLYHFDWKLAEGMKPSDMDMSEAEGLTGILKNNLLLVPTPYDPSS* | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 11,259.925 | ||
Theoretical pI: | 4.831 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 40.260 | ||
aromaticity | 0.093 | ||
GRAVY | 0.891 | ||
Secondary Structure Fraction | |||
Helix | 0.374 | ||
turn | 0.252 | ||
sheet | 0.234 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM051109.1 | complete | 107 | 625-302(-) |
Amino Acid sequence : | |||
MDQTLIMILALFGIVYPLTTHSSLHDLGINGIGGCILIVSFTTDFMYLSSCTSSTSQFVFSFSAALTSACAFAITAGFLISSASTHRVVVEDVSVPAENVSCTVKPL* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 11,259.925 | ||
Theoretical pI: | 4.831 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 40.260 | ||
aromaticity | 0.093 | ||
GRAVY | 0.891 | ||
Secondary Structure Fraction | |||
Helix | 0.374 | ||
turn | 0.252 | ||
sheet | 0.234 |