Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM051110.1 | complete | 187 | 367-930(+) |
Amino Acid sequence : | |||
MAELMRNPAVMAKAQAEVRAALKGKTNWDVDDVQELKYMKSVVKETMRMHPPIPLIPRSCREECKVNGYTIPNKARIMINVWSMGRNPLYWEKPETFRPERFDQVSRDFMGNDFEFIPFG AGRRICPGLNFGLANVEVPLTQLLYHFDWKLAEGMKPSDMDMSEAEGLTGIRKNNLLLVPTLYDPSS* | |||
Physicochemical properties | |||
Number of amino acids: | 187 | ||
Molecular weight: | 11,200.906 | ||
Theoretical pI: | 5.110 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 41.216 | ||
aromaticity | 0.094 | ||
GRAVY | 1.012 | ||
Secondary Structure Fraction | |||
Helix | 0.396 | ||
turn | 0.236 | ||
sheet | 0.226 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM051110.1 | complete | 106 | 617-297(-) |
Amino Acid sequence : | |||
MDHTLIMILALFGIVYPLTLHSSLHDLGINGIGGCILIVSFTTDFMYLSSCTSSTSQFVFPFSAALTSACAFAITAGFLISSAITHRVVVDDVSVPAENVSCTVVH* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,200.906 | ||
Theoretical pI: | 5.110 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 41.216 | ||
aromaticity | 0.094 | ||
GRAVY | 1.012 | ||
Secondary Structure Fraction | |||
Helix | 0.396 | ||
turn | 0.236 | ||
sheet | 0.226 |