Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM198971.1 | internal | 133 | 1-399(+) |
Amino Acid sequence : | |||
LGGETPTISQVAAIAARDNEVAVQLAESSRAGVKASSDWVMESMNKGTDSYGVTTGFGATIHRRTKQGGALQKELIRFLNAGIFGNGTESTHTLPHSATRAAMLVRINTLLQGYSGIRFE ILETITKFLNYNI | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 14,496.497 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 24.520 | ||
aromaticity | 0.098 | ||
GRAVY | -0.219 | ||
Secondary Structure Fraction | |||
Helix | 0.233 | ||
turn | 0.180 | ||
sheet | 0.301 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM198971.1 | internal | 133 | 399-1(-) |
Amino Acid sequence : | |||
NVIVQKFGNGFQNFKANAAIALQQGVNAHQHRRAGRAMRQGMGAFGAVAKNARVQKANQFFLQRAALFGAAMDGRAKAGGHAIAIGAFVHAFHHPIAARFHARAAAFRQLHRHFVIARRN RRHLANGRGFAAQ | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 14,496.497 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 24.520 | ||
aromaticity | 0.098 | ||
GRAVY | -0.219 | ||
Secondary Structure Fraction | |||
Helix | 0.233 | ||
turn | 0.180 | ||
sheet | 0.301 |