| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KM210339.1 | 5prime_partial | 102 | 1-309(+) |
Amino Acid sequence : | |||
| LCELQNPVNHRVFERKLRPRPSGRGHACLGVTPPVAPHSRADAEIGPPCSVRGGSKCRPSSGLARRMVDEYIVVCAYSPCPCPQQCDMSSSDPSPWTLPASE* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,012.489 | ||
| Theoretical pI: | 8.514 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8980 | ||
| Instability index: | 74.047 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.472 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.353 | ||
| sheet | 0.196 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KM210339.1 | 5prime_partial | 102 | 1-309(+) |
Amino Acid sequence : | |||
| LCELQNPVNHRVFERKLRPRPSGRGHACLGVTPPVAPHSRADAEIGPPCSVRGGSKCRPSSGLARRMVDEYIVVCAYSPCPCPQQCDMSSSDPSPWTLPASE* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,012.489 | ||
| Theoretical pI: | 8.514 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8980 | ||
| Instability index: | 74.047 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.472 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.353 | ||
| sheet | 0.196 | ||