Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM210339.1 | 5prime_partial | 102 | 1-309(+) |
Amino Acid sequence : | |||
LCELQNPVNHRVFERKLRPRPSGRGHACLGVTPPVAPHSRADAEIGPPCSVRGGSKCRPSSGLARRMVDEYIVVCAYSPCPCPQQCDMSSSDPSPWTLPASE* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,012.489 | ||
Theoretical pI: | 8.514 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8980 | ||
Instability index: | 74.047 | ||
aromaticity | 0.039 | ||
GRAVY | -0.472 | ||
Secondary Structure Fraction | |||
Helix | 0.196 | ||
turn | 0.353 | ||
sheet | 0.196 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM210339.1 | 5prime_partial | 102 | 1-309(+) |
Amino Acid sequence : | |||
LCELQNPVNHRVFERKLRPRPSGRGHACLGVTPPVAPHSRADAEIGPPCSVRGGSKCRPSSGLARRMVDEYIVVCAYSPCPCPQQCDMSSSDPSPWTLPASE* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,012.489 | ||
Theoretical pI: | 8.514 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8980 | ||
Instability index: | 74.047 | ||
aromaticity | 0.039 | ||
GRAVY | -0.472 | ||
Secondary Structure Fraction | |||
Helix | 0.196 | ||
turn | 0.353 | ||
sheet | 0.196 |