Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM272205.1 | complete | 342 | 1-1029(+) |
Amino Acid sequence : | |||
MGDLKSTFVKVYSVLKQELLEDPAFEWNDDARQWVHKMLDYNVPGGKLNRGLSVIDSYKLLKEGRELTEEEIFLASALGWCIEWLQAYFLVLDDIMDNSHTRRGQPCWFRLPKVGMIAVN DGVLLRNHIPRILRKHFRDKAYYVDLLDLFNEVEFQTASGQMIDLITTLEGEKDLSKYTLSVHRRIVQYKTAYYSFYLPVACALLMSGESLEKHIEVKDILVEMGTYFQVQDDYLDCFGD PATIGKIGTDIEDFKCSWLFVKALELCNEEQKKLLHENYGKADPENVKKVKALYHELNIQAVFLEYESKSYEKLITSIEAHPSKAVQAVLKSFLAKIYKRQK* | |||
Physicochemical properties | |||
Number of amino acids: | 342 | ||
Molecular weight: | 39,679.269 | ||
Theoretical pI: | 5.795 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 59820 60195 | ||
Instability index: | 39.238 | ||
aromaticity | 0.114 | ||
GRAVY | -0.256 | ||
Secondary Structure Fraction | |||
Helix | 0.365 | ||
turn | 0.161 | ||
sheet | 0.287 |