Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM397663.1 | internal | 310 | 1-930(+) |
Amino Acid sequence : | |||
IVWQTPANPDYIFQNGRHVRPYYFEFISHVKNRWAGKTIVDLFAEEFKGRPREYYVNAVKCGRIQVDGQNVHISYVVQSSQKISHFLHRHEPPVMAWKISVLHKEPDVITVCKPASVPVH PCGQYRKNTVVGILQAEYGLTPLFPVHRLDRLVSGLLIFARNADKADMFRQQIEAGMLQKEYIAKVIGMFPEGEQIASANVLYNAREGRSSVEKGKVACTKFTRISTNGIYSVVLCRPVT GRTHQIRVHLQYLGHPIANDTLYISFNIDPMCTNCPNLAPKGYDEEGLWLHCIRYTGPDWSYECPHPDWA | |||
Physicochemical properties | |||
Number of amino acids: | 310 | ||
Molecular weight: | 35,439.316 | ||
Theoretical pI: | 8.871 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 56840 57340 | ||
Instability index: | 34.116 | ||
aromaticity | 0.110 | ||
GRAVY | -0.287 | ||
Secondary Structure Fraction | |||
Helix | 0.332 | ||
turn | 0.226 | ||
sheet | 0.190 |