Acc_NO	ORF type	length	start-end position (strand +/-)
>KM397716.1	internal	120	1-360(+)
Amino Acid sequence :
AWTGEIHGKVVCDVCGDSSFGPEDIPLEGAEVAVLCITKSGDVINYQAFANSKGVYTVAETMPESDRWDSCLARPISSFHEHCTRRDSHSGIKFAYTHPSGYSHTVRPFLYRPATAPLYC
Physicochemical properties
Number of amino acids:		120
Molecular weight:		13,185.614
Theoretical pI:		5.805
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19940 20315
Instability index:		45.546
aromaticity		0.108
GRAVY		-0.248
Secondary Structure Fraction
Helix		0.275
turn		0.258
sheet		0.192