Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM397771.1 | internal | 316 | 1-948(+) |
Amino Acid sequence : | |||
DPSPLFRSLTAFAPATVANLGPGFDVLGCAVDGIGDHVTVSLDPSVPRGTVRIDSITRLSRNPNFNCAGIAAVETMRRLGVRSVGLSLSLEKGLPLGSGLGSSAASAAAAAAAVNGMFGG ALSHHALVLAGLESEARVSGRHADNIAPAIMGGFVLIRGYQPLDLHRLEFPDHKELFFVLASPEFEAPTKKMREALPREVAMAEVVHNSAQVAALVAAVLGGDARGVGSAMSADVIVEPR RAPLIPGMAAVKAAAVKAGAFGCTISGAGPTAVAVTDDEEMGREIGERMVEAFWRDGKLKAAATVRRLDRVGARVV | |||
Physicochemical properties | |||
Number of amino acids: | 316 | ||
Molecular weight: | 13,950.680 | ||
Theoretical pI: | 10.300 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 43.337 | ||
aromaticity | 0.042 | ||
GRAVY | 0.422 | ||
Secondary Structure Fraction | |||
Helix | 0.217 | ||
turn | 0.336 | ||
sheet | 0.294 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM397771.1 | 5prime_partial | 165 | 946-449(-) |
Amino Acid sequence : | |||
PPSPQPDQASARWPPPSASHPSKKPPPSAPRFPSPSPHHPSPPPRLARRHLWCIQKPPPSPPPPSPQPSRVSVAPASAPRSRPPTSLTPPPSRPLPAPPPPAPPPAQSCARPPPSPPPAA APPSSSSSAPRIPGSPTRRTAPCDPETLIYADPTAGIPGSGRTPP* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 13,950.680 | ||
Theoretical pI: | 10.300 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 43.337 | ||
aromaticity | 0.042 | ||
GRAVY | 0.422 | ||
Secondary Structure Fraction | |||
Helix | 0.217 | ||
turn | 0.336 | ||
sheet | 0.294 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM397771.1 | 3prime_partial | 150 | 452-3(-) |
Amino Acid sequence : | |||
MIAGAMLSAWRPLTLASDSSPARTSAWWDSAPPNMPLTAAAAAAALAALEPRPLPRGRPFSRERERPTDRTPSRLMVSTAAMPAQLKLGFRLRRVMESIRTVPRGTEGSRETVTWSPMPS TAQPRTSKPGPRLATVAGAKAVRERKRGEG | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 13,950.680 | ||
Theoretical pI: | 10.300 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 43.337 | ||
aromaticity | 0.042 | ||
GRAVY | 0.422 | ||
Secondary Structure Fraction | |||
Helix | 0.217 | ||
turn | 0.336 | ||
sheet | 0.294 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM397771.1 | 5prime_partial | 143 | 947-516(-) |
Amino Acid sequence : | |||
TTLAPTRSSLRTVAAAFSFPSLQKASTIRSPISLPISSSSVTATAVGPAPLMVHPKAPAFTAAAFTAAIPGISGARLGSTITSADIADPTPLASPPSTAATSAATCAELCTTSAIATSRG SASLIFFVGASNSGLANTKNSSL* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 13,950.680 | ||
Theoretical pI: | 10.300 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 43.337 | ||
aromaticity | 0.042 | ||
GRAVY | 0.422 | ||
Secondary Structure Fraction | |||
Helix | 0.217 | ||
turn | 0.336 | ||
sheet | 0.294 |