Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM398149.1 | 3prime_partial | 316 | 1-948(+) |
Amino Acid sequence : | |||
MDPLSALRDFTVRGELSKVTRVSDEIRFGSDYTFPAMAETAFRSKQGNLYTLETLLYFIQNHHLKHTDYLQSSRLHRLPSVTLPDRRPLLDYLHGRTSTSDSVLEIRSLERPLKDREALL ESKNRDFYGVLIASTKREEERQRMEVKPKAKIKGSKIGEGVPIILVPSAFQTLITIYNVKEFLEDGVFVPTEAKVKQGGGQRPEVVTVQKKLNRAVTAYEVRDKPSALRADDWDRVVAVF VLGKEWQFKDWPFKDHVEIFNKIIGFFVRFEDDSVESAKIVKQWNVKIISISKNKRHQDRAAALEVWDRLEEFVRS | |||
Physicochemical properties | |||
Number of amino acids: | 316 | ||
Molecular weight: | 12,060.155 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 97.145 | ||
aromaticity | 0.010 | ||
GRAVY | -1.231 | ||
Secondary Structure Fraction | |||
Helix | 0.204 | ||
turn | 0.388 | ||
sheet | 0.223 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM398149.1 | 5prime_partial | 112 | 2-340(+) |
Amino Acid sequence : | |||
WTLSPPSATSPSAASSRRSPASPTRSASAPTTPSLPWPRPPSVPSKATSTPSKPSSTSSRTTTSNTPTTSNPPASTASPPSPSPTAAPSSTTSTAAPPPPTPFLRSGPSNAL* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,060.155 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 97.145 | ||
aromaticity | 0.010 | ||
GRAVY | -1.231 | ||
Secondary Structure Fraction | |||
Helix | 0.204 | ||
turn | 0.388 | ||
sheet | 0.223 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM398149.1 | 5prime_partial | 103 | 3-314(+) |
Amino Acid sequence : | |||
GPSLRPPRLHRPRRALEGHPRLRRDPLRLRLHLPCHGRDRLPFQARQPLHPRNPPLLHPEPPPQTHRLPPILPPPPPPLRHPPRPPPPPRLPPRPHLHLRLRS* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 12,060.155 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 97.145 | ||
aromaticity | 0.010 | ||
GRAVY | -1.231 | ||
Secondary Structure Fraction | |||
Helix | 0.204 | ||
turn | 0.388 | ||
sheet | 0.223 |