Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM398262.1 | internal | 157 | 1-471(+) |
Amino Acid sequence : | |||
YSVWAIPPEGEVRDRLRRLMEGLRSDHGGPAFEPHVTVVGAIRLRRGDALRPYIAQVESVSRGGFFFQCVYLLLQPSPEVIKASAHCCSHFGYMNSTPYMPHLSLLYGELADEEKEKAIE RVKALDQSICKLHFQVSTLALYRTDTEDKTLQSWEKV | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 11,196.529 | ||
Theoretical pI: | 11.702 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 82.233 | ||
aromaticity | 0.037 | ||
GRAVY | -0.613 | ||
Secondary Structure Fraction | |||
Helix | 0.196 | ||
turn | 0.383 | ||
sheet | 0.224 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM398262.1 | 5prime_partial | 107 | 3-326(+) |
Amino Acid sequence : | |||
FGLGHSTGGGGQGPPQTSDGGSAVGPRRPGVRAARDGGGRDPSQARRRAEAVHRSGGVGQPRRILLPMRLSPPATFPGGHQSKCALLQPLWLHELHSLHAPLEPPIW* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 11,196.529 | ||
Theoretical pI: | 11.702 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 82.233 | ||
aromaticity | 0.037 | ||
GRAVY | -0.613 | ||
Secondary Structure Fraction | |||
Helix | 0.196 | ||
turn | 0.383 | ||
sheet | 0.224 |