Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM398314.1 | internal | 227 | 1-681(+) |
Amino Acid sequence : | |||
RFRMPTAENLIPMRLDIDVDGQRFKDSFLWNPNDPDSEMVIFAKRTVKDLGLPPGFVTQIAQSIQSQLMEFRALEGQEMYASERIVPIKLDLRVNKTVIRDQFLWDLSNFDSDPEEFARN FCSDLEIQDPEVGPAIAIAIREQLYEIVSQSVSSAREIRVGKKGRRVAEYITPSRAANNAMDLTKLFGNKASVIRKRKEWDLYEPLVDILSNEEAEALDAKEERNAR | |||
Physicochemical properties | |||
Number of amino acids: | 227 | ||
Molecular weight: | 26,066.301 | ||
Theoretical pI: | 4.957 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
Instability index: | 46.089 | ||
aromaticity | 0.079 | ||
GRAVY | -0.471 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.203 | ||
sheet | 0.286 |