Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM398478.1 | internal | 341 | 1-1023(+) |
Amino Acid sequence : | |||
PKRFIKQIPQSILNDPSLNAAISLLPSNYDFEVHKSVHRVLSSGARRVALQFPDGLLMYSLPISDILRSFVLADPTYGACCLDDLAASALGADLLIHYGHSCLVPVDVSAVPTLYVFVEI RADPSHLVSTVRSNIALAGTVQFAKTIAAAKPLLVLVPQSKPLSAGEVLGCTAPTIVVFVADGRFHLEAFMIANPSIKVHRYDPYLGRLFLESYDHEGMKEVRKCAILKARKASNWGVVF GTLGRQGNAGILGRLMEERGMVVMMSEISPTRMELFGDSVDAWVQIACPRLSIDWGDAFEKPMLTPFEAEIALGFIKGWWEYPMDYYAQDGGEWNSAYARK | |||
Physicochemical properties | |||
Number of amino acids: | 341 | ||
Molecular weight: | 10,479.027 | ||
Theoretical pI: | 7.867 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 50.160 | ||
aromaticity | 0.050 | ||
GRAVY | 0.378 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.360 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM398478.1 | 5prime_partial | 117 | 3-356(+) |
Amino Acid sequence : | |||
EALHKADPTIHPQRPFPQRRHIPSPLQLRLRGPQVRPPRPLLRRPPRRPPVPRRPPHVLPPHLRHPALLRPRRSHLRRLLPRRPRRLRPRRRPPHPLRPQLPRPRRRLRCPHPIRLR* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 10,479.027 | ||
Theoretical pI: | 7.867 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 50.160 | ||
aromaticity | 0.050 | ||
GRAVY | 0.378 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.360 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM398478.1 | complete | 100 | 947-645(-) |
Amino Acid sequence : | |||
MNPRAISASKGVSIGFSKASPQSIDNLGHAICTHASTESPNNSILVGEISDIITTIPLSSINLPSIPAFPCLPNVPKTTPQLLAFLALRIAHFLTSFIPS* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 10,479.027 | ||
Theoretical pI: | 7.867 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 50.160 | ||
aromaticity | 0.050 | ||
GRAVY | 0.378 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.360 | ||
sheet | 0.220 |