Acc_NO	ORF type	length	start-end position (strand +/-)
>KM398690.1	internal	214	1-642(+)
Amino Acid sequence :
TEGNGGLPKVLLNSAHGSEAEIYLFGGCITSWKPVNKDLLFVRPDAAFNGQKPISGGIPHCFPQFGPGPLQQHGFGRNMNWSVGDSENIEGNPVVTLELKDGPYSRSMWDFSFHAIYKVE LNSKSLTTVLTIKNTDKKPFSFSTALHTYFRASAAGASVKGLKGCKTLNKDPDPVNPSEGTEEREVVTFPGFLDCVYLDAPGEVHLDNGLGDVI
Physicochemical properties
Number of amino acids:		214
Molecular weight:		23,158.813
Theoretical pI:		5.657
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23950 24200
Instability index:		27.140
aromaticity		0.098
GRAVY		-0.300
Secondary Structure Fraction
Helix		0.294
turn		0.322
sheet		0.206