Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM398852.1 | 3prime_partial | 229 | 1-687(+) |
Amino Acid sequence : | |||
MADKPSRALVVYGDGFVPLVHAHIHSLASLASCGFLSVRATEEDRSIHELALLLDAHDATISERFMGLKACMFTLGFSVSRIDDLTEELLRLLGFEGGEVLEKSEFDMVFLHVWIDALVG RVIGVAQTQSRVASRLHLSLILSYGDIPRGNSDLCLLRPRQSYTMRGGDIRHHHPMLIAQWQDAVTRRDTAKQFSFTEFEEHGVNLAMLADRFLHEVAFKLWKAPKYGA | |||
Physicochemical properties | |||
Number of amino acids: | 229 | ||
Molecular weight: | 18,083.869 | ||
Theoretical pI: | 10.615 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 44.251 | ||
aromaticity | 0.058 | ||
GRAVY | -0.738 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.260 | ||
sheet | 0.182 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM398852.1 | 5prime_partial | 154 | 687-223(-) |
Amino Acid sequence : | |||
SSIFGRLPKLERNFMQETICKHCKIYPMLFKFRERKLLCRVPPSNCILPLRDQHRVMVSYIPPSHGVALPWPKQTKIRVSPRNVSIAQDQRQVKARSHSRLRLGDSNHPTNQRVNPNMQE NHVEFTLLKNLPSFESKQPQQLLRQIIDSRDTKP* | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 18,083.869 | ||
Theoretical pI: | 10.615 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 44.251 | ||
aromaticity | 0.058 | ||
GRAVY | -0.738 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.260 | ||
sheet | 0.182 |