Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM399127.1 | internal | 271 | 1-813(+) |
Amino Acid sequence : | |||
KLLMAAASAAAAETATFPIDLAKTRLQLHNESLTGRPTNAFRVASDLVRSEGLLSLYRGLSPALLRHLFYTPLRIVSYELLRPSSDSLASRAFAGGASGVLAQVVASPADLVKVRMQADG RRYSSAPDALMKIVRSEGLGGLWRGVVPNAQRAFLVNMGELTCYDYSKRRILNGGLCEDNLYAHTLASVASGLCSTMMSCPADVVKTRMMNQGVERVYRGSLDCLVRTVRAEGFGALWKG FFPTWARLGPWQFVFWVSYEQLRHAAGMSSF | |||
Physicochemical properties | |||
Number of amino acids: | 271 | ||
Molecular weight: | 12,217.347 | ||
Theoretical pI: | 11.891 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 88.011 | ||
aromaticity | 0.035 | ||
GRAVY | -1.484 | ||
Secondary Structure Fraction | |||
Helix | 0.061 | ||
turn | 0.491 | ||
sheet | 0.114 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM399127.1 | 5prime_partial | 178 | 3-539(+) |
Amino Acid sequence : | |||
AANGGGVRRGSGDGDVPDRPGEDSASAPQRVPDRPTHQRLPSRLRPCEIRGPPLPLQGPLPRPTPPPLLHSPPHRLLRAPPPLVRLSRIQGLRRRRLRRPRPGRGEPGRSGEGEDASGRT EVLERSGRSDEDRAVGGTRRAVERGGPERAESVLGQYGGIDVLRLLEASDLEWRALRG* | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 12,217.347 | ||
Theoretical pI: | 11.891 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 88.011 | ||
aromaticity | 0.035 | ||
GRAVY | -1.484 | ||
Secondary Structure Fraction | |||
Helix | 0.061 | ||
turn | 0.491 | ||
sheet | 0.114 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM399127.1 | 5prime_partial | 114 | 811-467(-) |
Amino Acid sequence : | |||
TMTFPPRAAAAHKKPRTQTARGRASPTSGRTPSKEPQNPQPSPSSPNNPKNPYRPSQPPDSSSVSSPRRPGSSSSSNRAPKRPKPTCARTSYPRKALHSRSDASSSRSTSIPPY* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 12,217.347 | ||
Theoretical pI: | 11.891 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 88.011 | ||
aromaticity | 0.035 | ||
GRAVY | -1.484 | ||
Secondary Structure Fraction | |||
Helix | 0.061 | ||
turn | 0.491 | ||
sheet | 0.114 |