Acc_NO	ORF type	length	start-end position (strand +/-)
>KM399503.1	internal	409	1-1227(+)
Amino Acid sequence :
EIHHRFSDPVRRWLPEKGTVEYYAHLAFRDRVFRGRRLVSFSEGNGTFRINNLGFLHYAVVTLGTPNSTFLVALDTGSDLFWVPCDCQQCAPDFEFSIYGTNASSTSKKVSCSSSLCRSK CSGEAACPYQVAYLSENTSSSGILVEDVLHLATEDKVVDAPIIFGCGQVQTGSFLDAAAPNGLFGLGMEKISVPSILARAGVISDSFSMCFGKDGLGRISFGDKGSSDQGETPFNVNPSY NVSVTGLSVGGTVGAKFDALVDTGTSFTCLADPAYSLLTEDFNALARDERDSKIPFDYCYLSSANKTASIPSISLSMKGGDVFPATGAIIFIPVNAGVVYCLGVVKSPNLNIIGQNFMTG LRIVFDRERLILGWKKFNCDVEDSSTLPINPRNSPPVPSVGQNNYTPQA
Physicochemical properties
Number of amino acids:		409
Molecular weight:		16,150.810
Theoretical pI:		11.920
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		39990 40240
Instability index:		50.173
aromaticity		0.090
GRAVY		0.057
Secondary Structure Fraction
Helix		0.319
turn		0.229
sheet		0.236

Acc_NO	ORF type	length	start-end position (strand +/-)
>KM399503.1	5prime_partial	144	2-436(+)
Amino Acid sequence :
KFTTGSPIPSGGGCRRRARWSTTRTSRSATASSADAGSSRSLKGTGLSASTTWDFCITRWLHWGRRTLLSWWRLIRGATSFGCRAIASSVRRILSSAFMVLMRHQRVRKCPAVVVCVGAN VLEKLLARIRLLIYLKILHLLEFW*
Physicochemical properties
Number of amino acids:		144
Molecular weight:		16,150.810
Theoretical pI:		11.920
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		39990 40240
Instability index:		50.173
aromaticity		0.090
GRAVY		0.057
Secondary Structure Fraction
Helix		0.319
turn		0.229
sheet		0.236