Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM399608.1 | 3prime_partial | 312 | 1-936(+) |
Amino Acid sequence : | |||
MKFKAGMRLEGLEILEGRFMAAVERVGGSWQLYLTRDHVMFLHNLLGGDGVQCVAQFSVSLLFHDYHISSRNADRIAFSVEPSLLHRALRSSLSILAHSSPLQMKLVKKLPAGSSRPAPF LSFETKGQKSAVIQDVPISRPLSAADVSDLHSALLSAQELPETLVQVPDLQQLQGLVDRLRHVGDVLSVSITRYGDLHLKLSSSLVTLGFEFRGLRILGVQASPLPNETSLSPQARMELA IQRGEAMSVQVSMKHLLKSIQCHLAKPDCTFFGIAPQGACLMVIFQFFIPGTRQTDKSISLHCRIPVLDSGS | |||
Physicochemical properties | |||
Number of amino acids: | 312 | ||
Molecular weight: | 11,262.527 | ||
Theoretical pI: | 4.842 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 42.320 | ||
aromaticity | 0.070 | ||
GRAVY | -0.429 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.180 | ||
sheet | 0.360 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM399608.1 | complete | 125 | 572-195(-) |
Amino Acid sequence : | |||
METERTSPTCLRRSTRPCSCWRSGTWTRVSGSSWADRRAECRSETSAAERGLDMGTSWMTADFCPLVSNERKGAGREEPAGSFFTSFIWRGEEWARMERELRRARWRRDGSTEKAIRSAL RLEMW* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 11,262.527 | ||
Theoretical pI: | 4.842 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 42.320 | ||
aromaticity | 0.070 | ||
GRAVY | -0.429 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.180 | ||
sheet | 0.360 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM399608.1 | complete | 100 | 765-463(-) |
Amino Acid sequence : | |||
MLHAHLHRHGFSSLYCQFHACLGTQRRFIWERACLDAEDPKATKLEAEGDEGAGELEVEVTIAGDGDRENIPNMPQTVYKTLQLLEVWNLDEGLRELLGG* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,262.527 | ||
Theoretical pI: | 4.842 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 42.320 | ||
aromaticity | 0.070 | ||
GRAVY | -0.429 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.180 | ||
sheet | 0.360 |