Acc_NO	ORF type	length	start-end position (strand +/-)
>KM400103.1	internal	308	1-924(+)
Amino Acid sequence :
AACEAAKAGDWEELKRMVADGADVTCFDGEGKTPLMYAAERGNAEAVELLLRAGAPWNALSPSGLSAGDFAMDNEAFDVLLNAGIQSELVLGAVARQTNKNSDSSEDYLKERVAFSEDRL MDSDSKAVMMAWEKPLMEAHARAICSGGSILNIGFGMGLIDTAIQQYTPVKHTIIEAHPEVYDRMLRSGWGEKDNVKIIFGRWQDVLSQLESYDGIFFDTYGEYYEDMREFHQHLPVLLK PGGIYSYFNGLCGGNAFFHVVYCQLVALELGNLGYSTQFIPLPVKDCLEEKIWEGVKHKYWQLDTYYL
Physicochemical properties
Number of amino acids:		308
Molecular weight:		26,265.654
Theoretical pI:		10.302
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13450
Instability index:		62.511
aromaticity		0.065
GRAVY		-0.038
Secondary Structure Fraction
Helix		0.341
turn		0.241
sheet		0.216

Acc_NO	ORF type	length	start-end position (strand +/-)
>KM400103.1	3prime_partial	232	696-1(-)
Amino Acid sequence :
MKFPHVFIILPIRVKKYPIIGLKLGKNILPTTKYYLHIIFLSPSGAKHSIINLRMSLNDCVLNRGILLNSCVYETHPKPNVQYTTTTTNCSSMSFHQWLLPSHHHCLAVGIHQSVLTKSN PLFQIVFTRITIFICLPCNCSKHQLRLNPCIEQHIEGLVVHGEVAGGETRRAEGVPRRASPEEQLNRLGVPALRRVHQGRFAFPVEARHVGAVRNHTLQLLPVPGLRRLARR
Physicochemical properties
Number of amino acids:		232
Molecular weight:		26,265.654
Theoretical pI:		10.302
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13450
Instability index:		62.511
aromaticity		0.065
GRAVY		-0.038
Secondary Structure Fraction
Helix		0.341
turn		0.241
sheet		0.216