Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM400211.1 | internal | 255 | 1-765(+) |
Amino Acid sequence : | |||
HHRLYEFAKAALIKIFVSPYATVCDLYCGDADKWDDAQIGHYIGIDGESWESQRKEYTAEFFEFDPCSETLESRLKDKDVVCCLQHLQLCFESEERVRSLLHNVSSLLRPGGYFFGIIPD SSTIWTKYQKNVEASHNRSTVPNCIRSENYVITFETEEEKFPLFGKRYQLKFANDHFLVHFPSLIRWAREAGLEYVEIQNLTEFYDDNRAQFAGMLNFVDPRGRLLPRSFDVLGLYSTFI FQKPDPDMVPPIMSP | |||
Physicochemical properties | |||
Number of amino acids: | 255 | ||
Molecular weight: | 29,727.268 | ||
Theoretical pI: | 5.216 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39880 40255 | ||
Instability index: | 49.735 | ||
aromaticity | 0.141 | ||
GRAVY | -0.360 | ||
Secondary Structure Fraction | |||
Helix | 0.341 | ||
turn | 0.208 | ||
sheet | 0.235 |