Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM400372.1 | internal | 175 | 1-525(+) |
Amino Acid sequence : | |||
VKRVAASCVWLASKLEESPRKGRQVIMVFHRMECRRENLPIEHMDAVSKKYAELKMDLNRTERHLLKEMGFICHVEHPHKFISNYLATLETPELRQESWNLANDSLRTTLCVRFKSEVVA CGVVYAAARRFKVPLPENPPWWLAFDADQSEIEEVCRVLAHLYGLPKAQYVPVCK | |||
Physicochemical properties | |||
Number of amino acids: | 175 | ||
Molecular weight: | 20,334.487 | ||
Theoretical pI: | 8.684 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29825 | ||
Instability index: | 63.905 | ||
aromaticity | 0.086 | ||
GRAVY | -0.283 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.166 | ||
sheet | 0.314 |