Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM400427.1 | internal | 168 | 1-504(+) |
Amino Acid sequence : | |||
ARKEDLPFIRCQVCRKIAEELHGLVQKKISPKMISELQIIDIAENVCNLKKEESDWILRIDIVEKGDTLELVDQGTEGQCNSECKTIERACQEVMGYSDTDVAEYIFKARPLCGDLTKAC APPIPKDRIPGEPFVAKSSKEAEMEKILRSMQGMPGAPNMKMYSKEDL | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 18,920.767 | ||
Theoretical pI: | 5.133 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10470 | ||
Instability index: | 50.061 | ||
aromaticity | 0.042 | ||
GRAVY | -0.452 | ||
Secondary Structure Fraction | |||
Helix | 0.250 | ||
turn | 0.190 | ||
sheet | 0.292 |