Acc_NO	ORF type	length	start-end position (strand +/-)
>KM400427.1	internal	168	1-504(+)
Amino Acid sequence :
ARKEDLPFIRCQVCRKIAEELHGLVQKKISPKMISELQIIDIAENVCNLKKEESDWILRIDIVEKGDTLELVDQGTEGQCNSECKTIERACQEVMGYSDTDVAEYIFKARPLCGDLTKAC APPIPKDRIPGEPFVAKSSKEAEMEKILRSMQGMPGAPNMKMYSKEDL
Physicochemical properties
Number of amino acids:		168
Molecular weight:		18,920.767
Theoretical pI:		5.133
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10470
Instability index:		50.061
aromaticity		0.042
GRAVY		-0.452
Secondary Structure Fraction
Helix		0.250
turn		0.190
sheet		0.292