Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM506777.1 | internal | 158 | 2-475(+) |
Amino Acid sequence : | |||
GRSVIVVGPSLSLPQCGKNREIAIELFQTFVKKEIIRQHIASNIGIAKSQIREKEPIESEVLQEVMQGHPVLLNRAPTLHRLGIQAFQPILVEGRAICLHPLVCKGFNAYFDGDQMAVHV PLSLEVQPQARLLLFFHMNLLSPAIGDSISVKTTSMLL | |||
Physicochemical properties | |||
Number of amino acids: | 158 | ||
Molecular weight: | 17,495.411 | ||
Theoretical pI: | 8.567 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 51.720 | ||
aromaticity | 0.051 | ||
GRAVY | 0.215 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.228 | ||
sheet | 0.278 |