Acc_NO	ORF type	length	start-end position (strand +/-)
>KM516273.1	internal	123	1-369(+)
Amino Acid sequence :
QAVPLSRSEKCIVGTGLERQTALGSGVSVIAEREGKIIYTDTYKIIFSSNGDTISIPLVMYRRSNKNTCMHQKPQVQRGKCIKKGQILADGAATVGGELALGKNVLVAYMPWEGYNSEDA VLI
Physicochemical properties
Number of amino acids:		123
Molecular weight:		13,317.236
Theoretical pI:		9.055
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13075
Instability index:		35.346
aromaticity		0.057
GRAVY		-0.126
Secondary Structure Fraction
Helix		0.301
turn		0.252
sheet		0.228