Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM597494.1 | internal | 120 | 1-360(+) |
Amino Acid sequence : | |||
LVEYATNRSLPVIIVCASGGARMQEGSLSLMQMAKISSASYNYQSNKKLFYVSILTSPTTGGVTASFGMLGDVIIAEPNACIAFAGKRVIEQTLNKTIPDDSQAAEYSFHKGLFDPIVPR | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 12,880.677 | ||
Theoretical pI: | 7.963 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
Instability index: | 51.342 | ||
aromaticity | 0.083 | ||
GRAVY | 0.124 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.275 | ||
sheet | 0.250 |