Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM823794.1 | internal | 151 | 1-453(+) |
Amino Acid sequence : | |||
EWWRLFACVWLHAGVVHLLANMLSLLFIGIRLEQEFGFAKIGVLYVISGFGGSLMSAFSIQSKISVGASGALFGLLGAMLSELITNWSIYANKFAALITLIVIIGINMAVGFIPHVDSSA HIGGFITGFLLGFVLLIRPQFGWVNRKYIPP | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 16,443.428 | ||
Theoretical pI: | 9.364 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 31970 | ||
Instability index: | 26.638 | ||
aromaticity | 0.139 | ||
GRAVY | 1.002 | ||
Secondary Structure Fraction | |||
Helix | 0.470 | ||
turn | 0.258 | ||
sheet | 0.278 |