Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM823795.1 | 5prime_partial | 269 | 1-810(+) |
Amino Acid sequence : | |||
EREREMGGIPPPQPGFPNRRDPPPLLDFFRRHDSSFQNLFHSSYLSRIKRVSSEKPVPSKRDFWGIPAIISGGNGFSRFLGNFGNSLSRRSTCTDALLSMNVLLYMAQVATRGRLTAWGC LSRSHVDRGEVWRLVTSSLLHANILHLYVNNTSLDHIGRVVEDRDGPRRFLAVYFTSALTGSAMSYCFLKSCSLGASGSIFGLIGSHAVYVMRHKNLPGRDKQLEQIVDTLYLNMAIGLV IKRIDNWGHLGGLLGGAAVSWFICPPMVT* | |||
Physicochemical properties | |||
Number of amino acids: | 269 | ||
Molecular weight: | 29,922.112 | ||
Theoretical pI: | 9.919 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38180 | ||
Instability index: | 46.737 | ||
aromaticity | 0.097 | ||
GRAVY | -0.093 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.301 | ||
sheet | 0.219 |