Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM823796.1 | 5prime_partial | 320 | 1-963(+) |
Amino Acid sequence : | |||
FILRLDIYRGNPAQHNSTPKNEPFIFLGVQAVQMVQLGLLKPSVAISTGATRSAQTPVLGTCGRHPPPLVPRVRTLVPVGSLRGSLGRPTMVPSLSRRSMHLRSAGNSDMMSQLELGKPE EKGPKKRVNGIFWILLLNIGIYVADHLFKIRGIKALYFYHARPAWYEFITSAFCHANWNHLSSNLFFLYIFGKLVEEEEGNFGLWLSYIVTGAGANLVSWLVLPRNSVSIGASGAVFGLF AISVLVKMSWDWRKMLEVLILGQFVIEKVMEAAQASVGMSGPFAIGTYFQNINHIAHLSGALVGAALILLISRIPNKSSD* | |||
Physicochemical properties | |||
Number of amino acids: | 320 | ||
Molecular weight: | 12,005.471 | ||
Theoretical pI: | 9.462 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 63.535 | ||
aromaticity | 0.104 | ||
GRAVY | -0.546 | ||
Secondary Structure Fraction | |||
Helix | 0.255 | ||
turn | 0.283 | ||
sheet | 0.236 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM823796.1 | 5prime_partial | 109 | 2-331(+) |
Amino Acid sequence : | |||
SFSGWTSTGATQHNTTQPPKTSLSFFWGSKQSRWCSWAFSSLPWRSQPGLRDPHRRPCSARAAVILPRSSLACGPSSPSEVLEGAWAGRPWSLLCLGGLCTCAVRETLI* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,005.471 | ||
Theoretical pI: | 9.462 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 63.535 | ||
aromaticity | 0.104 | ||
GRAVY | -0.546 | ||
Secondary Structure Fraction | |||
Helix | 0.255 | ||
turn | 0.283 | ||
sheet | 0.236 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KM823796.1 | complete | 106 | 797-477(-) |
Amino Acid sequence : | |||
MTNCPNISTSSIFLQSQDILTRTLIANSPKTAPEAPMETEFLGRTNHETRFAPAPVTIYESHKPKFPSSSSTSFPKIYKKNKLLERWFQLAWQNAEVINSYQAGRA* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 12,005.471 | ||
Theoretical pI: | 9.462 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 63.535 | ||
aromaticity | 0.104 | ||
GRAVY | -0.546 | ||
Secondary Structure Fraction | |||
Helix | 0.255 | ||
turn | 0.283 | ||
sheet | 0.236 |