| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KP072715.1 | internal | 179 | 1-537(+) |
Amino Acid sequence : | |||
| AGVKDYRLTYYTPDYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVAGEENQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALR LEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECL | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 19,810.222 | ||
| Theoretical pI: | 6.189 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
| Instability index: | 27.280 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.292 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.223 | ||
| sheet | 0.257 | ||