Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KP072717.1 | internal | 179 | 1-537(+) |
Amino Acid sequence : | |||
AGVKDYRLTYYTPDYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVAGEENQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALR LEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECL | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 19,810.222 | ||
Theoretical pI: | 6.189 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
Instability index: | 27.280 | ||
aromaticity | 0.117 | ||
GRAVY | -0.292 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.223 | ||
sheet | 0.257 |