Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KP072726.1 | internal | 277 | 2-832(+) |
Amino Acid sequence : | |||
YVSDILIPYPIHMEILVQILQCRIQDVPFLHLLRFFLHEYHNCNSLLITQNKSIYVFSNENKRLFQLLYNSYAFECEFLLVFFRKQSYYLRLTSSATFLERTHFYRKIEHLRIEHFFVVC RNYFHRTRWFFKNPFMHYVRYQRKAIVASRGTHFLMKKWKSHFVNFWQYYFRFWSRPYRIHINHLSNYSFYFLGYFSSLLINSSAXRNQMLENSFLMDTVTKKFDTIVPVILLIESLSKA KFCTVSGHPISKPIWADFSDSDIIDRFGRICRNLSHY | |||
Physicochemical properties | |||
Number of amino acids: | 277 | ||
Molecular weight: | 33,796.865 | ||
Theoretical pI: | 9.694 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 55810 56185 | ||
Instability index: | 46.254 | ||
aromaticity | 0.196 | ||
GRAVY | -0.093 | ||
Secondary Structure Fraction | |||
Helix | 0.431 | ||
turn | 0.188 | ||
sheet | 0.185 |