Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KP072729.1 | internal | 277 | 2-832(+) |
Amino Acid sequence : | |||
YVSDILIPYPIHMEILVQILQCRIQDVPFLHLLRFFLHEYHNCNSLLITQNKSIYVFSNENKRLFQLLYNSYAFECEFLLVFFRKQSYYLRLTSSATFLERTHFYRKIEHLRIEHFFVVC RNYFHRTRWFFKNPFMHYVRYQRKAIVASRGTHFLMKKWKSHFVNFWQYYFRFWSRPYRIHINHLSNYSFYFLGYFSSLLINSSAVRNQMLENSFLMDTVTKKFDTIVPVILLIESLSKA KFCTVSGHPISKPIWADFSDSDIIDRFGRICRNLSHY | |||
Physicochemical properties | |||
Number of amino acids: | 277 | ||
Molecular weight: | 33,895.996 | ||
Theoretical pI: | 9.694 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 55810 56185 | ||
Instability index: | 46.123 | ||
aromaticity | 0.195 | ||
GRAVY | -0.077 | ||
Secondary Structure Fraction | |||
Helix | 0.433 | ||
turn | 0.188 | ||
sheet | 0.184 |