Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KP076225.1 | internal | 109 | 2-328(+) |
Amino Acid sequence : | |||
RAKHHAAVPSVCVGVRHGEPVQGGRRAVAGILDPLLLHHPPGDGGRACPLLDTGVVPSEAAVRGLAGAPAVQGRLLHLRQGRQGAAQEVPRQEPQRRRRSQGAHTQGRG | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,721.732 | ||
Theoretical pI: | 8.021 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39420 39420 | ||
Instability index: | 39.418 | ||
aromaticity | 0.156 | ||
GRAVY | 0.106 | ||
Secondary Structure Fraction | |||
Helix | 0.431 | ||
turn | 0.174 | ||
sheet | 0.294 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KP076225.1 | internal | 109 | 329-3(-) |
Amino Acid sequence : | |||
SLGLEYVHLVIGVAVAVPAAVLPELLPDDLVVDEGGALELRERQPGHEQQLHWVPHRYPVEDRLGHHLQEGDEGVEDPVCQPLLVVHLGRALHGAHRRIQRVQQRDAWP | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,721.732 | ||
Theoretical pI: | 8.021 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39420 39420 | ||
Instability index: | 39.418 | ||
aromaticity | 0.156 | ||
GRAVY | 0.106 | ||
Secondary Structure Fraction | |||
Helix | 0.431 | ||
turn | 0.174 | ||
sheet | 0.294 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KP076225.1 | internal | 109 | 3-329(+) |
Amino Acid sequence : | |||
GPSITLLYPLYASVCAMESPSKVDDEQWLAYWILYSFITLLEMVAEPVLYWIPVWYPVKLLFVAWLALPQFKGASFIYDKVVREQLRKYRGRNRNGDADHKVHILKAEA | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,721.732 | ||
Theoretical pI: | 8.021 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39420 39420 | ||
Instability index: | 39.418 | ||
aromaticity | 0.156 | ||
GRAVY | 0.106 | ||
Secondary Structure Fraction | |||
Helix | 0.431 | ||
turn | 0.174 | ||
sheet | 0.294 |