Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KP172047.1 | internal | 191 | 2-574(+) |
Amino Acid sequence : | |||
YYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPVA YVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRW | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 21,429.055 | ||
Theoretical pI: | 5.777 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34630 | ||
Instability index: | 35.534 | ||
aromaticity | 0.120 | ||
GRAVY | -0.388 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.230 | ||
sheet | 0.230 |