| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KP190192.1 | complete | 159 | 57-536(+) |
Amino Acid sequence : | |||
| MSDDPTDTRLKPLADSPASALTGIPKFGPSQITPDGYAVNTMQPPHWPSASRDPQRPDYADASKANVLPAQKHAHIGYKLTEKGIDWAKTARISLLVLISSSIINRLTILKTLARAIRLP ESNTYVMADWGTPQRLTIFSPMYKPVNYRPSPSINRKVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 15,060.958 | ||
| Theoretical pI: | 11.059 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 24980 | ||
| Instability index: | 67.963 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.669 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.271 | ||
| sheet | 0.143 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KP190192.1 | complete | 133 | 539-940(+) |
Amino Acid sequence : | |||
| MHAGYSDVEAGDRHIAHIIDQLQRSPQWKNTVVVITFDENGGWWDPVAPPKGDRWGPGSRIPALVISPFARRGHVDNTQYDTGSILRFISRVHDLPLLKRLNRTRSRIDGTRPSKNGKKA PAQRNLVIIPRRT* | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 15,060.958 | ||
| Theoretical pI: | 11.059 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 24980 | ||
| Instability index: | 67.963 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.669 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.271 | ||
| sheet | 0.143 | ||