Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KP190192.1 | complete | 159 | 57-536(+) |
Amino Acid sequence : | |||
MSDDPTDTRLKPLADSPASALTGIPKFGPSQITPDGYAVNTMQPPHWPSASRDPQRPDYADASKANVLPAQKHAHIGYKLTEKGIDWAKTARISLLVLISSSIINRLTILKTLARAIRLP ESNTYVMADWGTPQRLTIFSPMYKPVNYRPSPSINRKVT* | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 15,060.958 | ||
Theoretical pI: | 11.059 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 24980 | ||
Instability index: | 67.963 | ||
aromaticity | 0.068 | ||
GRAVY | -0.669 | ||
Secondary Structure Fraction | |||
Helix | 0.278 | ||
turn | 0.271 | ||
sheet | 0.143 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KP190192.1 | complete | 133 | 539-940(+) |
Amino Acid sequence : | |||
MHAGYSDVEAGDRHIAHIIDQLQRSPQWKNTVVVITFDENGGWWDPVAPPKGDRWGPGSRIPALVISPFARRGHVDNTQYDTGSILRFISRVHDLPLLKRLNRTRSRIDGTRPSKNGKKA PAQRNLVIIPRRT* | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 15,060.958 | ||
Theoretical pI: | 11.059 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 24980 | ||
Instability index: | 67.963 | ||
aromaticity | 0.068 | ||
GRAVY | -0.669 | ||
Secondary Structure Fraction | |||
Helix | 0.278 | ||
turn | 0.271 | ||
sheet | 0.143 |