Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KP198546.1 | internal | 104 | 3-314(+) |
Amino Acid sequence : | |||
ESHGAIDGHLREVGLTFHLLKDVPGLKSKNIEKSLKEAFDPSGISDWNSIFWIAHPGGPAILDQVVDKLALKPDKMRATRHVLSEYGNMSSACVLSILDEMRKA | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,232.818 | ||
Theoretical pI: | 9.729 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 48.939 | ||
aromaticity | 0.108 | ||
GRAVY | -0.062 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.304 | ||
sheet | 0.186 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KP198546.1 | 5prime_partial | 102 | 316-8(-) |
Amino Acid sequence : | |||
DAFLISSSIDKTQALDIFPYSLNTCRVARILSGFRASLSTTWSRIAGPPGCAIQKIEFQSEIPDGSKASFKLFSMFLDLRPGTSFKRWNVSPTSRKCPSIAP* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,232.818 | ||
Theoretical pI: | 9.729 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 48.939 | ||
aromaticity | 0.108 | ||
GRAVY | -0.062 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.304 | ||
sheet | 0.186 |