Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KP245903.1 | internal | 152 | 1-456(+) |
Amino Acid sequence : | |||
GRPFDMLDAALSDTVSRFPVDIQPFRDMVEGMRMDLWKSRYNNFDELYLYCYYVAGTVGLMSVPIMGIAPESKATTESVYNAALALGIANQLTNILRDVGEDARRGRVYLPQDELAQAGL SDEDIFAGRVTDKWRMFMKKQIQRARKFFDEA | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 17,335.620 | ||
Theoretical pI: | 5.034 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
Instability index: | 40.930 | ||
aromaticity | 0.112 | ||
GRAVY | -0.274 | ||
Secondary Structure Fraction | |||
Helix | 0.309 | ||
turn | 0.184 | ||
sheet | 0.289 |