Acc_NO	ORF type	length	start-end position (strand +/-)
>KP265012.1	internal	116	3-350(+)
Amino Acid sequence :
PLQKPKQDRYALRTSPQWLGPQIEVIRAATKMIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNTRLALASIGKLMFAQFSELVNDYYNNGLPSNLTAGRNPSLDYGLKG
Physicochemical properties
Number of amino acids:		116
Molecular weight:		12,799.387
Theoretical pI:		9.415
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11460 11460
Instability index:		42.504
aromaticity		0.069
GRAVY		-0.474
Secondary Structure Fraction
Helix		0.284
turn		0.319
sheet		0.241