| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KP712708.1 | internal | 234 | 3-704(+) |
Amino Acid sequence : | |||
| QPKTKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGSDPVIGVERPLFQ LVSAAQTLLPESHGAIDGHLREVGLTFHLLKDVPGLKSKNIEKSLKEAFDPSGISDWNSIFWIAHPGGPAILDQVVDKLALKPDKMRATRHVLSEYGNMSSACVLSILDEMRKA | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 11,232.818 | ||
| Theoretical pI: | 9.729 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 48.939 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.062 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.304 | ||
| sheet | 0.186 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KP712708.1 | 5prime_partial | 102 | 706-398(-) |
Amino Acid sequence : | |||
| DAFLISSSIDKTQALDIFPYSLNTCRVARILSGFRASLSTTWSRIAGPPGCAIQKIEFQSEIPDGSKASFKLFSMFLDLRPGTSFKRWNVSPTSRKCPSIAP* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,232.818 | ||
| Theoretical pI: | 9.729 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 48.939 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.062 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.304 | ||
| sheet | 0.186 | ||